HORDB

ID: hor004661
Uniprot ID: Q6NMF0
Protein name: CLAVATA3/ESR (CLE)-related protein 13
Gene name: CLE13
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE13p]: Mostly expressed in seedlings, roots, flowers, stems and apex, and, to a lower extent, in leaves and siliques.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: LFGNFSSKPINPFPSPVITLPALYYRPGRRALAVKTFDFTPFLKDLRRSNHRKALPAGGSEIDPRYGVEKRLVPSGPNPLHH
Length: 82
Propeptide: MATTRVSHVLGFLLWISLLIFVSIGLFGNFSSKPINPFPSPVITLPALYYRPGRRALAVKTFDFTPFLKDLRRSNHRKALPAGGSEIDPRYGVEKRLVPSGPNPLHH
Signal peptide: MATTRVSHVLGFLLWISLLIFVSIG
Modification: T74 Hydroxyproline;T77 Hydroxyproline
Glycosylation: T4 N-linked (GlcNAc...) asparagine;T77 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004661_AF2.pdb

hor004661_ESM.pdb

Mass:	1064055	Formula:	C424H659N121O109
Absent amino acids:	CMQW	Common amino acids:	P
pI:	11.27	Basic residues:	16
Polar residues:	22	Hydrophobic residues:	27
Hydrophobicity:	-47.2	Boman Index:	-14819
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	77.32
Instability Index:	7040.85	Extinction Coefficient cystines:	4470
Absorbance 280nm:	55.19