General Information

  • ID:  hor004661
  • Uniprot ID:  Q6NMF0
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 13
  • Gene name:  CLE13
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE13p]: Mostly expressed in seedlings, roots, flowers, stems and apex, and, to a lower extent, in leaves and siliques.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0010078 maintenance of root meristem identity; GO:0010088 phloem development; GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment; GO:0045595 regulation of cell differentiation
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  LFGNFSSKPINPFPSPVITLPALYYRPGRRALAVKTFDFTPFLKDLRRSNHRKALPAGGSEIDPRYGVEKRLVPSGPNPLHH
  • Length:  82(26-107)
  • Propeptide:  MATTRVSHVLGFLLWISLLIFVSIGLFGNFSSKPINPFPSPVITLPALYYRPGRRALAVKTFDFTPFLKDLRRSNHRKALPAGGSEIDPRYGVEKRLVPSGPNPLHH
  • Signal peptide:  MATTRVSHVLGFLLWISLLIFVSIG
  • Modification:  T74 Hydroxyproline;T77 Hydroxyproline
  • Glycosylation:  T4 N-linked (GlcNAc...) asparagine;T77 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate. Represses root apical meristem maintenance.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6NMF0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004661_AF2.pdbhor004661_ESM.pdb

Physical Information

Mass: 1064055 Formula: C424H659N121O109
Absent amino acids: CMQW Common amino acids: P
pI: 11.27 Basic residues: 16
Polar residues: 22 Hydrophobic residues: 27
Hydrophobicity: -47.2 Boman Index: -14819
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 77.32
Instability Index: 7040.85 Extinction Coefficient cystines: 4470
Absorbance 280nm: 55.19

Literature

  • PubMed ID:  NA
  • Title:  NA